PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004184-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 271aa    MW: 31438.5 Da    PI: 6.106
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004184-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.84.9e-131461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G  +W+++++  g+ R++k+c++rw +yl
    NNU_004184-RA 14 RGPWTIEEDHKLMNFILNNGIQCWRLVPKLAGLMRCGKSCRLRWINYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.91.8e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++ E++++++++ +lG++ W++Ia++++ gRt++++k++w++
    NNU_004184-RA  67 RGALSEVEEDQIIQLHSRLGNR-WSKIAAHFP-GRTDNEIKNHWNT 110
                      788899****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.004961IPR017930Myb domain
SuperFamilySSF466891.59E-2711108IPR009057Homeodomain-like
SMARTSM007172.7E-51363IPR001005SANT/Myb domain
PfamPF002491.8E-111461IPR001005SANT/Myb domain
CDDcd001671.38E-41661No hitNo description
PROSITE profilePS5129425.27762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
SMARTSM007173.8E-1566114IPR001005SANT/Myb domain
PfamPF002494.7E-1567110IPR001005SANT/Myb domain
CDDcd001671.00E-1071110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRKPCCEKI GLKRGPWTIE EDHKLMNFIL NNGIQCWRLV PKLAGLMRCG KSCRLRWINY  60
LRPDLKRGAL SEVEEDQIIQ LHSRLGNRWS KIAAHFPGRT DNEIKNHWNT RIKKRLKIMG  120
LDPVTHKPIE QREKCNSEAE QLSRFHSQRE QQKDLKIEPL DTPGLEDAPL PQMEGEDSFQ  180
PGSDETINVL HGYEMLWEDL DMGMMINPEN NPTNSYSSSF SLEDSFSRST GESSSLQEDS  240
GQCWINNVNY SIPQWDLFHN VDDIFLLKNN Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250868.10.0PREDICTED: myb-related protein 315-like
RefseqXP_010250867.10.0PREDICTED: myb-related protein 315-like
TrEMBLF6GX581e-109F6GX58_VITVI; Putative uncharacterized protein
STRINGVIT_14s0219g00050.t011e-108(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.14e-81myb domain protein 40